TNRC6A monoclonal antibody (M11), clone 2E7

Product Sizes

100 ug

£333.00

H00027327-M11-100UG

About this Product

SKU:: H00027327-M11
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2e7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant TNRC6A.
Host:: Mouse
Immunogen:: TNRC6A (NP_055309, 454 a.a. ~ 553 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: NNTTNFMTSSLPNSGSVQNNELPSSNTGAWRVSTMNHPQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQANGDTVNATLMQP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket