SMPDL3B monoclonal antibody (M01), clone 5E12
Product Sizes
100 ug
£333.00
H00027293-M01-100UG
About this Product
- SKU:
- H00027293-M01
- Application:
- ELISA, Western Blot
- translate.label.attr.clone:
- 5E12
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant SMPDL3B.
- Host:
- Mouse
- Immunogen:
- SMPDL3B (NP_001009568, 274 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG3, kappa
- Reactivities:
- Human
- Sequence:
- FFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGLKCITTFPHSQLIHLPLTTEPQE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00027293-M01
