STAU2 monoclonal antibody (M14), clone 3B7

Product Sizes

100 ug

£333.00

H00027067-M14-100UG

About this Product

SKU:: H00027067-M14
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 3B7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant STAU2.
Host:: Mouse
Immunogen:: STAU2 (NP_055208, 341 a.a. ~ 440 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: LGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket