GNL3 monoclonal antibody (M09), clone 4B10

Product Sizes

100 ug

£333.00

H00026354-M09-100UG

About this Product

SKU:: H00026354-M09
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4B10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant GNL3.
Host:: Mouse
Immunogen:: GNL3 (AAH01024.1, 328 a.a. ~ 427 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket