MYCBP monoclonal antibody (M08), clone 1F10

Product Sizes

100 ug

£333.00

H00026292-M08-100UG

About this Product

SKU:: H00026292-M08
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1F10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MYCBP.
Host:: Mouse
Immunogen:: MYCBP (NP_036465.2, 34 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: LYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket