SHFM3P1 monoclonal antibody (M15), clone 2C5

Product Sizes

100 ug

£333.00

H00026226-M15-100UG

About this Product

SKU:: H00026226-M15
Application:: ELISA, Immunofluorescence
translate.label.attr.clone:: 2C5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SHFM3P1.
Host:: Mouse
Immunogen:: SHFM3P1 (AAF04527, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: EVLLLHMCSYLDMRALGRLAQVYRWLWHFTNCDLLRRQIAWASLNSGFTRLGTNLMTSVPVKVSQNWIVGCCREGILLKWRCSQMPWMQLEDDALYISQA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket