PRPF31 monoclonal antibody (M02), clone 8E1

Product Sizes

100 ug

£333.00

H00026121-M02-100UG

About this Product

SKU:: H00026121-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 8E1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PRPF31.
Host:: Mouse
Immunogen:: PRPF31 (NP_056444, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Rat
Sequence:: GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket