CLDN14 monoclonal antibody (M01), clone 3D11
Product Sizes
100 ug
£333.00
H00023562-M01-100UG
About this Product
- SKU:
- H00023562-M01
- Application:
- ELISA, Immunoprecipitation
- translate.label.attr.clone:
- 3D11
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant CLDN14.
- Host:
- Mouse
- Immunogen:
- CLDN14 (NP_036262, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG2a, kappa
- Reactivities:
- Human
- Sequence:
- HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00023562-M01
