CCRK monoclonal antibody (M02), clone 4D6

Product Sizes

100 ug

£333.00

H00023552-M02-100UG

About this Product

SKU:: H00023552-M02
Application:: ELISA, IHC-Paraffin
translate.label.attr.clone:: 4D6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant CCRK.
Host:: Mouse
Immunogen:: CCRK (AAH02655, 1 a.a. ~ 275 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket