CLCF1 monoclonal antibody (M01A), clone 7E10

Product Sizes

200 ul

£333.00

H00023529-M01A-200UL

About this Product

SKU:: H00023529-M01A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 7E10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant CLCF1.
Host:: Mouse
Immunogen:: CLCF1 (AAH12939, 29 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgM, kappa
Reactivities:: Human
Sequence:: NRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket