ABCA6 monoclonal antibody (M01), clone 2F1

Product Sizes

100 ug

£333.00

H00023460-M01-100UG

About this Product

SKU:: H00023460-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2F1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ABCA6.
Host:: Mouse
Immunogen:: ABCA6 (NP_525023, 53 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket