SYNE2 monoclonal antibody (M01), clone 5E5

Product Sizes

100 ug

£333.00

H00023224-M01-100UG

About this Product

SKU:: H00023224-M01
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 5E5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SYNE2.
Host:: Mouse
Immunogen:: SYNE2 (NP_055995, 6702 a.a. ~ 6799 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket