SULF1 monoclonal antibody (M01A), clone 1A4

Product Sizes

200 ul

£333.00

H00023213-M01A-200UL

About this Product

SKU:: H00023213-M01A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1A4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SULF1.
Host:: Mouse
Immunogen:: SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgM, kappa
Reactivities:: Human
Sequence:: RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket