MRPS27 monoclonal antibody (M06), clone 1G3

Product Sizes

100 ug

£333.00

H00023107-M06-100UG

About this Product

SKU:: H00023107-M06
Application:: ELISA
translate.label.attr.clone:: 1G3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant MRPS27.
Host:: Mouse
Immunogen:: MRPS27 (AAH30521, 51 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: SEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket