P2RX2 monoclonal antibody (M02), clone 3D5

Product Sizes

50 ug

£333.00

H00022953-M02-50UG

About this Product

SKU:: H00022953-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3D5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant P2RX2.
Host:: Mouse
Immunogen:: P2RX2 (NP_036358.2, 128 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: KNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPAS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket