SLC4A1AP monoclonal antibody (M01), clone 2G10

Product Sizes

100 ug

£333.00

H00022950-M01-100UG

About this Product

SKU:: H00022950-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2G10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SLC4A1AP.
Host:: Mouse
Immunogen:: SLC4A1AP (NP_060628, 154 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: YQEPPWGGPATAPYSLETLKGGTILGTRSLKGTSYCLFGRLSGCDVCLEHPSVSRYHAVLQHRASGPDGECDSNGPGFYLYDLGSTHGTFLNKTRIPPRTY
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket