SP140 monoclonal antibody (M07), clone 3F9

Product Sizes

100 ug

£333.00

H00011262-M07-100UG

About this Product

SKU:: H00011262-M07
Application:: ELISA, IHC-Paraffin, Immunofluorescence
translate.label.attr.clone:: 3F9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SP140.
Host:: Mouse
Immunogen:: SP140 (NP_009168.3, 504 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket