TBC1D8 monoclonal antibody (M02), clone 1A12

Product Sizes

100 ug

£333.00

H00011138-M02-100UG

About this Product

SKU:: H00011138-M02
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1A12
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant TBC1D8.
Host:: Mouse
Immunogen:: TBC1D8 (NP_008994, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLHAVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIILPLREVVSIEKME
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket