UBE2C monoclonal antibody (M12), clone 1D8

Product Sizes

100 ug

£333.00

H00011065-M12-100UG

About this Product

SKU:: H00011065-M12
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1D8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant UBE2C.
Host:: Mouse
Immunogen:: UBE2C (AAH16292.1, 25 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: GAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVR
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket