EDAR monoclonal antibody (M02A), clone 3A7

Product Sizes

200 ul

£333.00

H00010913-M02A-200UL

About this Product

SKU:: H00010913-M02A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3A7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant EDAR.
Host:: Mouse
Immunogen:: EDAR (NP_071731, 64 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket