TRIM16 monoclonal antibody (M02), clone 5G11

Product Sizes

50 ug

£333.00

H00010626-M02-50UG

About this Product

SKU:: H00010626-M02
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 5G11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant TRIM16.
Host:: Mouse
Immunogen:: TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket