DCTN2 monoclonal antibody (M01), clone 2G7

Product Sizes

100 ug

£333.00

H00010540-M01-100UG

About this Product

SKU:: H00010540-M01
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2G7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DCTN2.
Host:: Mouse
Immunogen:: DCTN2 (AAH00718, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, lambda
Reactivities:: Human
Sequence:: DADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket