DEAF1 monoclonal antibody (M11), clone 3C12

Product Sizes

100 ug

£333.00

H00010522-M11-100UG

About this Product

SKU:: H00010522-M11
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3C12
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DEAF1.
Host:: Mouse
Immunogen:: DEAF1 (NP_066288.2, 133 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket