LYPLA1 monoclonal antibody (M05), clone 3D5

Product Sizes

100 ug

£333.00

H00010434-M05-100UG

About this Product

SKU:: H00010434-M05
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 3D5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant LYPLA1.
Host:: Mouse
Immunogen:: LYPLA1 (AAH08652.1, 66 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket