CFDP1 monoclonal antibody (M04), clone 5B7

Product Sizes

100 ug

£333.00

H00010428-M04-100UG

About this Product

SKU:: H00010428-M04
Application:: ELISA, Western Blot
translate.label.attr.clone:: 5B7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CFDP1.
Host:: Mouse
Immunogen:: CFDP1 (NP_006315, 168 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: VFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket