PCGF3 monoclonal antibody (M03), clone 1F1

Product Sizes

100 ug

£333.00

H00010336-M03-100UG

About this Product

SKU:: H00010336-M03
Application:: ELISA, IHC-Paraffin
translate.label.attr.clone:: 1F1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PCGF3.
Host:: Mouse
Immunogen:: PCGF3 (NP_006306, 133 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: SNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket