OLIG2 monoclonal antibody (M03), clone 3C9

Product Sizes

100 ug

£333.00

H00010215-M03-100UG

About this Product

SKU:: H00010215-M03
Application:: ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
translate.label.attr.clone:: 3C9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant OLIG2.
Host:: Mouse
Immunogen:: OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket