ELA3A monoclonal antibody (M02), clone 3G4

Product Sizes

100 ug

£333.00

H00010136-M02-100UG

About this Product

SKU:: H00010136-M02
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 3G4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant ELA3A.
Host:: Mouse
Immunogen:: ELA3A (AAH07028, 16 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket