ACTR1B monoclonal antibody (M05), clone 4E10

Product Sizes

100 ug

£333.00

H00010120-M05-100UG

About this Product

SKU:: H00010120-M05
Application:: ELISA, Immunofluorescence
translate.label.attr.clone:: 4E10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ACTR1B.
Host:: Mouse
Immunogen:: ACTR1B (NP_005726, 191 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: SRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHK*
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket