OXSR1 monoclonal antibody (M06C), clone 1C8
Product Sizes
200 ul
£333.00
H00009943-M06C-200UL
About this Product
- SKU:
- H00009943-M06C
- Additional Names:
- CXGrade
- Application:
- ELISA, Western Blot
- translate.label.attr.clone:
- 1C8
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant OXSR1. This product is belong to Cell Culture Grade Antibody (CX Grade).
- Host:
- Mouse
- Immunogen:
- OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG3, kappa
- Reactivities:
- Human
- Sequence:
- KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00009943-M06C
