ENTH monoclonal antibody (M03), clone 1E6

Product Sizes

100 ug

£333.00

H00009685-M03-100UG

About this Product

SKU:: H00009685-M03
Application:: ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1E6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ENTH.
Host:: Mouse
Immunogen:: ENTH (NP_055481.1, 161 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKH
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket