SEC22B monoclonal antibody (M03), clone 5A10

Product Sizes

100 ug

£333.00

H00009554-M03-100UG

About this Product

SKU:: H00009554-M03
Application:: ELISA, Western Blot
translate.label.attr.clone:: 5A10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SEC22B.
Host:: Mouse
Immunogen:: SEC22B (NP_004883, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, lambda
Reactivities:: Human, Rat
Sequence:: MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPY
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket