GOSR1 monoclonal antibody (M13), clone 2C2

Product Sizes

100 ug

£333.00

H00009527-M13-100UG

About this Product

SKU:: H00009527-M13
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2C2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant GOSR1.
Host:: Mouse
Immunogen:: GOSR1 (NP_004862.1, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: AAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket