AKAP5 monoclonal antibody (M04), clone 1A9

Product Sizes

100 ug

£333.00

H00009495-M04-100UG

About this Product

SKU:: H00009495-M04
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1A9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant AKAP5.
Host:: Mouse
Immunogen:: AKAP5 (NP_004848.2, 334 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: RMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQ
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket