GGPS1 monoclonal antibody (M08), clone 1C3

Product Sizes

100 ug

£333.00

H00009453-M08-100UG

About this Product

SKU:: H00009453-M08
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1C3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant GGPS1.
Host:: Mouse
Immunogen:: GGPS1 (NP_004828, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: NKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket