CYP7B1 monoclonal antibody (M06), clone 2B11

Product Sizes

100 ug

£333.00

H00009420-M06-100UG

About this Product

SKU:: H00009420-M06
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 2B11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CYP7B1.
Host:: Mouse
Immunogen:: CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket