LONP1 monoclonal antibody (M01), clone 3B2

Product Sizes

100 ug

£333.00

H00009361-M01-100UG

About this Product

SKU:: H00009361-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3B2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant LONP1.
Host:: Mouse
Immunogen:: LONP1 (NP_004784.2, 661 a.a. ~ 761 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: YVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket