MAPKAPK2 monoclonal antibody (M08), clone 3B8

Product Sizes

100 ug

£333.00

H00009261-M08-100UG

About this Product

SKU:: H00009261-M08
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 3B8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant MAPKAPK2.
Host:: Mouse
Immunogen:: MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket