DYRK1B monoclonal antibody (M10), clone 2E8

Product Sizes

100 ug

£333.00

H00009149-M10-100UG

About this Product

SKU:: H00009149-M10
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2E8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DYRK1B.
Host:: Mouse
Immunogen:: DYRK1B (AAH25291, 479 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket