USP14 monoclonal antibody (M08), clone 1F8

Product Sizes

100 ug

£333.00

H00009097-M08-100UG

About this Product

SKU:: H00009097-M08
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1F8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant USP14.
Host:: Mouse
Immunogen:: USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket