PAPSS2 monoclonal antibody (M07), clone 2A8

Product Sizes

100 ug

£333.00

H00009060-M07-100UG

About this Product

SKU:: H00009060-M07
Application:: ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2A8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PAPSS2.
Host:: Mouse
Immunogen:: PAPSS2 (NP_004661, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Mouse
Sequence:: DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket