VNN1 monoclonal antibody (M05), clone 2B10

Product Sizes

100 ug

£333.00

H00008876-M05-100UG

About this Product

SKU:: H00008876-M05
Application:: ELISA, Immunoprecipitation
translate.label.attr.clone:: 2B10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant VNN1.
Host:: Mouse
Immunogen:: VNN1 (NP_004657, 298 a.a. ~ 397 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: KLLLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQI
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket