AKAP4 monoclonal antibody (M10), clone 4G1

Product Sizes

100 ug

£333.00

H00008852-M10-100UG

About this Product

SKU:: H00008852-M10
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4G1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant AKAP4.
Host:: Mouse
Immunogen:: AKAP4 (NP_003877, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG3, kappa
Reactivities:: Human
Sequence:: MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket