PCAF monoclonal antibody (M13), clone 1E3

Product Sizes

100 ug

£333.00

H00008850-M13-100UG

About this Product

SKU:: H00008850-M13
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1E3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant PCAF.
Host:: Mouse
Immunogen:: PCAF (NP_003875, 367 a.a. ~ 432 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: QDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket