BANF1 monoclonal antibody (M01), clone 3F10-4G12

Product Sizes

100 ug

£333.00

H00008815-M01-100UG

About this Product

SKU:: H00008815-M01
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 3F10-4G12
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant BANF1.
Host:: Mouse
Immunogen:: BANF1 (AAH05942, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket