B4GALT4 monoclonal antibody (M01), clone 5E2

Product Sizes

100 ug

£333.00

H00008702-M01-100UG

About this Product

SKU:: H00008702-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 5E2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant B4GALT4.
Host:: Mouse
Immunogen:: B4GALT4 (NP_003769, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: VGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNRE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket