AOC3 monoclonal antibody (M06), clone 4B8

Product Sizes

100 ug

£333.00

H00008639-M06-100UG

About this Product

SKU:: H00008639-M06
Application:: ELISA, Immunofluorescence
translate.label.attr.clone:: 4B8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant AOC3.
Host:: Mouse
Immunogen:: AOC3 (NP_003725, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket