CGGBP1 monoclonal antibody (M02), clone 1D11

Product Sizes

100 ug

£333.00

H00008545-M02-100UG

About this Product

SKU:: H00008545-M02
Application:: ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1D11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CGGBP1.
Host:: Mouse
Immunogen:: CGGBP1 (NP_003654, 58 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: ISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket