BARX2 monoclonal antibody (M01), clone 2B8

Product Sizes

50 ug

£333.00

H00008538-M01-50UG

About this Product

SKU:: H00008538-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2B8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant BARX2.
Host:: Mouse
Immunogen:: BARX2 (NP_003649, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: PDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket