DGKE monoclonal antibody (M03), clone 7E1

Product Sizes

100 ug

£333.00

H00008526-M03-100UG

About this Product

SKU:: H00008526-M03
Application:: ELISA, Western Blot
translate.label.attr.clone:: 7E1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DGKE.
Host:: Mouse
Immunogen:: DGKE (NP_003638, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG3, lambda
Reactivities:: Human, Mouse, Rat
Sequence:: CKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket